PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000387787
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 260aa    MW: 29753.9 Da    PI: 4.9391
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000387787genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1775.1e-5561331128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v++
  MDP0000387787   6 LPPGFRFHPTDEELVNYYLKRKINGQEIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVTC 100
                    79****************************.99**************84335556888************************************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++++g+kktLv+y+grap+g +tdWvmheyrl
  MDP0000387787 101 -QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                    .8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.63E-624165IPR003441NAC domain
PROSITE profilePS5100559.1176165IPR003441NAC domain
PfamPF023652.9E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKING QEIELDIIPE VDLYKCEPWE LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVTC QNRAIGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKDYYC SSDPDTSSSS AAIQDSFALC RVFKKNGICS EIEEQQGQSS  180
HLTLNNIHER SQGVNNDHCD QTLSPENPMA SSSSISCPQE EDDKDDSWMQ FITDDTWMQC  240
SSNAGVSGED QLSHVAFTN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-55216611169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009355961.10.0PREDICTED: protein BEARSKIN1
SwissprotQ9FFI53e-88NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A068TRH51e-140A0A068TRH5_COFCA; Uncharacterized protein
STRINGPOPTR_0015s05450.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95643343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-125NAC domain containing protein 57